Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial

This Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial spans the amino acid sequence from region 270-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proton-coupled zinc antiporter SLC30A1; Solute carrier family 30 member 1; Zinc transporter 1; SLC30A1 ZNT1

UniProt

Q9Y6M5

Expression Region

270-308

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM161A Polyclonal Antibody, Cy7 Conjugated
bs-8216R-Cy7 100 µL

FAM161A Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
CKM Antibody
orb522066-01 50 μL

CKM Antibody

Sign In for Pricing
View Details
CKM Antibody
orb522066-02 100 µL

CKM Antibody

Sign In for Pricing
View Details
Chicken Cholinesterase (BCHE) ELISA Kit
MBS2607555-01 48 Well

Chicken Cholinesterase (BCHE) ELISA Kit

Sign In for Pricing
View Details
Chicken Cholinesterase (BCHE) ELISA Kit
MBS2607555-02 96 Well

Chicken Cholinesterase (BCHE) ELISA Kit

Sign In for Pricing
View Details
Chicken Cholinesterase (BCHE) ELISA Kit
MBS2607555-03 5x 96 Well

Chicken Cholinesterase (BCHE) ELISA Kit

Sign In for Pricing
View Details