Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tab2 Mouse Gene Knockout Kit (CRISPR)
KN517118 1 Kit

Tab2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Fluoroanisole
TRC-F587670-25G 25 g

2-Fluoroanisole

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc Protein (aa 104-327, Leu325Pro)
PKSH033651-01 10 µg

Recombinant Human IgG4-Fc Protein (aa 104-327, Leu325Pro)

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc Protein (aa 104-327, Leu325Pro)
PKSH033651-02 50 µg

Recombinant Human IgG4-Fc Protein (aa 104-327, Leu325Pro)

Sign In for Pricing
View Details
EIF4E pSer209 Rabbit Polyclonal Antibody
AP02491PU-N 100 µL

EIF4E pSer209 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF594 conjugate, 0.1mg/mL
BNC942894-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details