Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NDFIP2 activation kit by CRISPRa
GA110196 1 Kit

Human NDFIP2 activation kit by CRISPRa

Sign In for Pricing
View Details
HCG-intact (HCGab/52), CF647 conjugate, 0.1mg/mL
BNC470052-100 1x 100 µL

HCG-intact (HCGab/52), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF594 conjugate, 0.1mg/mL
BNC943073-100 1x 100 µL

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHEMX (TSPAN32) Human Gene Knockout Kit (CRISPR)
KN424210 1 Kit

PHEMX (TSPAN32) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KRTAP13-4 activation kit by CRISPRa
GA117181 1 Kit

Human KRTAP13-4 activation kit by CRISPRa

Sign In for Pricing
View Details
Casz1 Mouse Gene Knockout Kit (CRISPR)
KN502578 1 Kit

Casz1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details