Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 27 (TVA27)

This Recombinant Human T cell receptor alpha variable 27 (TVA27) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 27 TRAV27

UniProt

A0A087WT01

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQTGDTGLYLCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Over-expression Lysate
LH20115V 100 µg

Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Over-expression Lysate

Sign In for Pricing
View Details
Mdm2 Rat Pre-designed siRNA Set A
HY-RS08266 1 Set

Mdm2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
CHRM3 Recombinant Antibody, Cy5 Conjugated
bsm-61645R-Cy5-TR 20 µL

CHRM3 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
CHO-K1/ADORA1/Gα15 Stable Cell Line
M00324 2 Vials

CHO-K1/ADORA1/Gα15 Stable Cell Line

Sign In for Pricing
View Details
BTNL2 Antibody, Biotin conjugated
MBS7046403-01 0.05 mg

BTNL2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
BTNL2 Antibody, Biotin conjugated
MBS7046403-02 0.1 mg

BTNL2 Antibody, Biotin conjugated

Sign In for Pricing
View Details