Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-5 (TVB65)

This Recombinant Human T cell receptor beta variable 6-5 (TVB65) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-5 TRBV6-5

UniProt

A0A0K0K1A5

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYK2 (PTK2B) (NM_173175) Human Recombinant Protein
TP317684L 1 mg

PYK2 (PTK2B) (NM_173175) Human Recombinant Protein

Sign In for Pricing
View Details
SFTPA2 Rabbit Polyclonal Antibody
TA369381 100 µL

SFTPA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabif Mouse Gene Knockout Kit (CRISPR)
KN514398 1 Kit

Rabif Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biological Safety Cabinet Class II BCBS-204
BCBS-204 1 Unit

Biological Safety Cabinet Class II BCBS-204

Sign In for Pricing
View Details
LAP3 Recombinant Rabbit Monoclonal Antibody [PSH01-34]
HA721658 100 µL

LAP3 Recombinant Rabbit Monoclonal Antibody [PSH01-34]

Sign In for Pricing
View Details
Chondroitin Sulfate C Sodium Salt (Technical Grade)
TRC-C433378-5G 5 g

Chondroitin Sulfate C Sodium Salt (Technical Grade)

Sign In for Pricing
View Details