Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein myomixer (MYMX), partial

This Recombinant Human Protein myomixer (MYMX), partial spans the amino acid sequence from region 26-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein myomixer; Microprotein inducer of fusion; Protein minion; hMINION; MYMX

UniProt

A0A1B0GTQ4

Expression Region

26-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b Rat Monoclonal Antibody [Clone ID: 3A33]
AM08031PU-N 500 µg

CD11b Rat Monoclonal Antibody [Clone ID: 3A33]

Sign In for Pricing
View Details
IRX2 Antibody
8C11651-AAT 50 µg

IRX2 Antibody

Sign In for Pricing
View Details
Recombinant Human SUMF1 Protein (His Tag)
PKSH033084-01 10 µg

Recombinant Human SUMF1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SUMF1 Protein (His Tag)
PKSH033084-02 50 µg

Recombinant Human SUMF1 Protein (His Tag)

Sign In for Pricing
View Details
Granulocyte Marker (BM-2), 1mg/mL
BNUM0062-50 1x 50 µL

Granulocyte Marker (BM-2), 1mg/mL

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF640R conjugate, 0.1mg/mL
BNC401654-100 1x 100 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details