Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229)

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Axl Antibody BIOTIN-Conjugated
MBS541030-01 0.1 mg

Axl Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
Axl Antibody BIOTIN-Conjugated
MBS541030-02 5x 0.1 mg

Axl Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details
LEF1 Human Over-expression Lysate
orb1361215 20 µg

LEF1 Human Over-expression Lysate

Sign In for Pricing
View Details
Regular Mounting Fluid ()
RMF-2.5 2.5 mL

Regular Mounting Fluid ()

Sign In for Pricing
View Details
Lentiviral mouse Aldh2 shRNA (UAS) - Lentiviral mouseAldh2 shRNA (UAS, GFP) (25)
GTR15184472 1 Vial

Lentiviral mouse Aldh2 shRNA (UAS) - Lentiviral mouseAldh2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Olfactory receptor 8D1 (OR8D1) ELISA Kit
MBS7210712-01 48 Well

Rat Olfactory receptor 8D1 (OR8D1) ELISA Kit

Sign In for Pricing
View Details