Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229)

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Cell Membrane DNA Antibody ELISA Kit
MBS046280-01 48 Well

Bovine Cell Membrane DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cell Membrane DNA Antibody ELISA Kit
MBS046280-02 96 Well

Bovine Cell Membrane DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cell Membrane DNA Antibody ELISA Kit
MBS046280-03 5x 96 Well

Bovine Cell Membrane DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cell Membrane DNA Antibody ELISA Kit
MBS046280-04 10x 96 Well

Bovine Cell Membrane DNA Antibody ELISA Kit

Sign In for Pricing
View Details
Anti-HYI Antibody Picoband® Fluoro550 Conjugated
A14191-2-Fluoro550 100 µg/Vial

Anti-HYI Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
CHRNB Rabbit pAb, PerCP-Cy7 conjugated
orb2863338 100 µL

CHRNB Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details