Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229)

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL1, ID (DVL1, Segment polarity protein dishevelled homolog DVL-1, DSH homolog 1) (FITC)
MBS6293898-01 0.2 mL

DVL1, ID (DVL1, Segment polarity protein dishevelled homolog DVL-1, DSH homolog 1) (FITC)

Sign In for Pricing
View Details
DVL1, ID (DVL1, Segment polarity protein dishevelled homolog DVL-1, DSH homolog 1) (FITC)
MBS6293898-02 5x 0.2 mL

DVL1, ID (DVL1, Segment polarity protein dishevelled homolog DVL-1, DSH homolog 1) (FITC)

Sign In for Pricing
View Details
YAP1 Recombinant Rabbit mAb, BF700 conjugated
orb3001032 100 µL

YAP1 Recombinant Rabbit mAb, BF700 conjugated

Sign In for Pricing
View Details
IL17RD Recombinant Protein C-His Tag Lyophilized 100ug
IHUIL17RDRCHISLY100UG 100 µg

IL17RD Recombinant Protein C-His Tag Lyophilized 100ug

Sign In for Pricing
View Details
BOC-L-Alanine-OH
48689135-25g 25 g

BOC-L-Alanine-OH

Sign In for Pricing
View Details
Clic6-set siRNA/shRNA/RNAi Lentivector (Rat)
16345096 4x 500 ng

Clic6-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details