Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229)

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-2Rα (H-6) : m-IgG2a BP-HRP Bundle
sc-548146 1 Kit

IL-2Rα (H-6) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
N-[4- (4,5-dichloro-1H-imidazol-1-yl) phenyl]-2,1,3-benzothiadiazole-4-sulphonamide
OR25657 1 Each

N-[4- (4,5-dichloro-1H-imidazol-1-yl) phenyl]-2,1,3-benzothiadiazole-4-sulphonamide

Sign In for Pricing
View Details
Human EFNA5 (Ephrin A5) Microsample ELISA Kit
orb2998338-01 48 Tests

Human EFNA5 (Ephrin A5) Microsample ELISA Kit

Sign In for Pricing
View Details
Human EFNA5 (Ephrin A5) Microsample ELISA Kit
orb2998338-02 96 Tests

Human EFNA5 (Ephrin A5) Microsample ELISA Kit

Sign In for Pricing
View Details
Innovative Grade US Origin Porcine Gallbladder Fresh in PBS
IGPCGBP 1 Each

Innovative Grade US Origin Porcine Gallbladder Fresh in PBS

Sign In for Pricing
View Details
KCNA1 Protein Lysate (Human) with C-Ha Tag
25324031 100 µg

KCNA1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details