Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTEN upstream open reading frame MP31 (MP31)

This Recombinant Human PTEN upstream open reading frame MP31 (MP31) spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTEN upstream open reading frame MP31; Micropeptide 31; Mitochondrial lactate dehydrogenase regulator; MLDHR MP31

UniProt

C0HLV8

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpv17 (NM_008622) Mouse Tagged ORF Clone
MG201540 10 µg

Mpv17 (NM_008622) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL
BNC681788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM131C Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF810729 100 µg

FAM131C Mouse Monoclonal Antibody [Clone ID: OTI1C2]

Sign In for Pricing
View Details
hnRNP K (HNRNPK) Rabbit Polyclonal Antibody
AP01359PU-N 100 µg

hnRNP K (HNRNPK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Proliferation Marker (JC1), 1mg/mL
BNUM3329-50 1x 50 µL

Proliferation Marker (JC1), 1mg/mL

Sign In for Pricing
View Details
5000?l tip box with ultra low retention tip BPIC-716
BPIC-716 1 Unit

5000?l tip box with ultra low retention tip BPIC-716

Sign In for Pricing
View Details