Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human SLC18A2 Polyclonal Antibody
HC560014-01 50 µg

Anti-Human SLC18A2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human SLC18A2 Polyclonal Antibody
HC560014-02 100 µg

Anti-Human SLC18A2 Polyclonal Antibody

Sign In for Pricing
View Details
Mug1 Protein Vector (Mouse) (pPM-C-His)
PV203025 500 ng

Mug1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
ELISA Kit for Protein Kinase B Gamma (PKBg)
TRV-0063750-01 24 Tests

ELISA Kit for Protein Kinase B Gamma (PKBg)

Sign In for Pricing
View Details
ELISA Kit for Protein Kinase B Gamma (PKBg)
TRV-0063750-02 48 Tests

ELISA Kit for Protein Kinase B Gamma (PKBg)

Sign In for Pricing
View Details
ELISA Kit for Protein Kinase B Gamma (PKBg)
TRV-0063750-03 96 Tests

ELISA Kit for Protein Kinase B Gamma (PKBg)

Sign In for Pricing
View Details