Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial

This Recombinant Human CNK3/IPCEF1 fusion protein (CNIPF), partial spans the amino acid sequence from region 332-457. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNK3/IPCEF1 fusion protein CNK3/IPCEF1

UniProt

G9CGD6

Expression Region

332-457

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 (CDKN1A) (NM_001220778) Human Untagged Clone
SC329916 10 µg

p21 (CDKN1A) (NM_001220778) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rhmD Protein (aa 1-428)
VAng-0071Lsx-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Sonnei rhmD Protein (aa 1-428)

Sign In for Pricing
View Details
PSMC6 (FITC)
573667-01 50 µg

PSMC6 (FITC)

Sign In for Pricing
View Details
PSMC6 (FITC)
573667-02 100 µg

PSMC6 (FITC)

Sign In for Pricing
View Details
Recombinant Clostridium Cellulolyticum trpC Protein (aa 1-260)
VAng-Lsx9059-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Cellulolyticum trpC Protein (aa 1-260)

Sign In for Pricing
View Details
Mouse AMTN shRNA Plasmid
abx977413-01 150 µg

Mouse AMTN shRNA Plasmid

Sign In for Pricing
View Details