Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Suppressyn (SUPYN)

This Recombinant Human Suppressyn (SUPYN) spans the amino acid sequence from region 40-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Suppressyn; Endogenous retrovirus group 48 member 1; NDUFV3 antisense RNA 1; endogenous retrovirus group Fb member 1; ERVH48-1 C21orf105 HERV-Fb1 NDUFV3-AS1

UniProt

M5A8F1

Expression Region

40-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APPSCRECYQSLHYRGEMQQYFTYHTHIERSCYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGVNTQVLEDIKREQIIAKAKASKPTTPPENRPRHFHSFIQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody
AP51044PU-N 400 µL

Carboxypeptidase A2 (CPA2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF568 conjugate, 0.1mg/mL
BNC682273-100 1x 100 µL

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL
BNC550242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EP2 (PTGER2) (NM_000956) Human Over-expression Lysate
LY424431 100 µg

EP2 (PTGER2) (NM_000956) Human Over-expression Lysate

Sign In for Pricing
View Details
HGF / SF (EGH2 4C12.1), CF405S conjugate, 0.1mg/mL
BNC042841-100 1x 100 µL

HGF / SF (EGH2 4C12.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634960 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details