Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXTL3 Antibody - middle region
OAGA01767-100UL 100 µL

EXTL3 Antibody - middle region

Sign In for Pricing
View Details
RNF36, ID (H215) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (Biotin) discontinued
R2031-90A-Biotin 200 µL

RNF36, ID (H215) (Tripartite motif-containing protein 69, RING finger protein 36, RFP-like domain-containing protein trimless, HSD34, HSD-34, TRIM69) (Biotin) discontinued

Sign In for Pricing
View Details
Kaempferide
S3879-10mM/1mL 10 mM/1mL

Kaempferide

Sign In for Pricing
View Details
ADA2 Chemi-Luminescent ELISA Kit (Human) (OKCD03366)
OKCD03366 96 Well

ADA2 Chemi-Luminescent ELISA Kit (Human) (OKCD03366)

Sign In for Pricing
View Details
Laminin γ-3 Polyclonal Conjugated Antibody
C41103 100 µL

Laminin γ-3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ITPKB, NT (ITPKB, Inositol-trisphosphate 3-kinase B, Inositol 1,4,5-trisphosphate 3-kinase B) (APC)
MBS6311423-01 0.2 mL

ITPKB, NT (ITPKB, Inositol-trisphosphate 3-kinase B, Inositol 1,4,5-trisphosphate 3-kinase B) (APC)

Sign In for Pricing
View Details