Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alisol E 23-acetate
orb1683197 10 mg

Alisol E 23-acetate

Sign In for Pricing
View Details
D-AP5 25mg
A17044-25 25 mg

D-AP5 25mg

Sign In for Pricing
View Details
Gstt4 ORF Vector (Rat) (pORF)
22775016 1.0 µg DNA

Gstt4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Influenza B (Nucleoprotein) (MaxLight 750) discontinued, see I7651-58A-MaxLightTM750
I7651-16C-ML750 100 µL

Influenza B (Nucleoprotein) (MaxLight 750) discontinued, see I7651-58A-MaxLightTM750

Sign In for Pricing
View Details
QPCT (Glutaminyl-peptide Cyclotransferase, Glutaminyl Cyclase, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase) (HRP)
132147-HRP 100 µL

QPCT (Glutaminyl-peptide Cyclotransferase, Glutaminyl Cyclase, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase) (HRP)

Sign In for Pricing
View Details
Acy3 Mouse shRNA Plasmid (Locus ID 71670)
TR509062 1 Kit

Acy3 Mouse shRNA Plasmid (Locus ID 71670)

Sign In for Pricing
View Details