Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribosome biogenesis inhibitor MINAS-60 (MNS60)

This Recombinant Human Ribosome biogenesis inhibitor MINAS-60 (MNS60) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosome biogenesis inhibitor MINAS-60; MINAS-60; RBM10

UniProt

P0DW28

Expression Region

1-130

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKDVVVVVTGLAAMEPLTARRMMVGRTAAETTTTGTWTTVHILASMAARRASMTMTTHLRSRVRRIPTRPPRAPRLSVGGGGGTGTAPPARQASPETATIGTRTIGPSKGRRRRRRRMRRRRRRPVTSSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maltose Binding Protein / MBP-probe (R29.6), CF405S conjugate, 0.1mg/mL
BNC042847-500 1x 500 µL

Maltose Binding Protein / MBP-probe (R29.6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alogliptin Benzoate
TRC-A575440-250MG 250 mg

Alogliptin Benzoate

Sign In for Pricing
View Details
Ethyl 2-aminobenzoate
TRC-E287266-500MG 500 mg

Ethyl 2-aminobenzoate

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF568 conjugate, 0.1mg/mL
BNC681543-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
11-(3-Bromopropylidene)-6,11-dihydrodibenzo[b,e]oxepine
TRC-B673545-25MG 25 mg

11-(3-Bromopropylidene)-6,11-dihydrodibenzo[b,e]oxepine

Sign In for Pricing
View Details
Acid sphingomyelinase Recombinant Rabbit monoclonal Antibody
HA723768 100 µL

Acid sphingomyelinase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details