Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial

This Recombinant Human Armadillo repeat-containing X-linked protein 3 (ARMX3), partial spans the amino acid sequence from region 30-379. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Armadillo repeat-containing X-linked protein 3; ARM protein lost in epithelial cancers on chromosome X 3; Protein ALEX3; ARMCX3 ALEX3 BM-017 UNQ2517/PRO6007

UniProt

Q9UH62

Expression Region

30-379

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (PE)
MBS6488433-01 0.2 mL

MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (PE)

Sign In for Pricing
View Details
MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (PE)
MBS6488433-02 5x 0.2 mL

MLX, ID (Max-like Protein X, Max-like bHLHZip Protein, BigMax Protein, Transcription Factor-like Protein 4, Class D Basic Helix-loop-helix Protein 13, bHLHd13, TCFL4) (PE)

Sign In for Pricing
View Details
ORP-9 HDR Plasmid (h)
sc-410255-HDR 20 µg

ORP-9 HDR Plasmid (h)

Sign In for Pricing
View Details
Recombinant Shigella Boydii recX Protein (aa 1-166) (strain CDC 3083-94 / BS512)
VAng-Lsx08782-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii recX Protein (aa 1-166) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details
FUT6 Rabbit Polyclonal Antibody
E28PN6828 100 µL

FUT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Apoptosis-related protein 3 (C2orf28) ELISA Kit
MBS7242643-01 48 Well

Sheep Apoptosis-related protein 3 (C2orf28) ELISA Kit

Sign In for Pricing
View Details