Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5)

This Recombinant Human Tesmin (MTL5) spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CARF Affinity Purified Polyclonal Ab
AF4195-SP 25 µg

Human CARF Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Trolamine
414418 5.0mL

Trolamine

Sign In for Pricing
View Details
FABP5P15 Protein Vector (Human) (pPB-C-His)
PV076449 500 ng

FABP5P15 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human RL (Reelin) ELISA Kit
EK242886 96 Well

Human RL (Reelin) ELISA Kit

Sign In for Pricing
View Details
Ankrd13b Mouse Gene Knockout Kit (CRISPR)
KN501267 1 Kit

Ankrd13b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Breast cancer type 2 susceptibility protein homolog (Brca2) ELISA Kit
RK08046 96 Tests

Rat Breast cancer type 2 susceptibility protein homolog (Brca2) ELISA Kit

Sign In for Pricing
View Details