Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B5 (PCDGH), partial

This Recombinant Human Protocadherin gamma-B5 (PCDGH), partial spans the amino acid sequence from region 31-687. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protocadherin gamma-B5; PCDH-gamma-B5; PCDHGB5

UniProt

Q9Y5G0

Expression Region

31-687

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
AP20367PU-N 100 µg

Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), Biotin conjugate, 0.1mg/mL
BNCB1706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Atractyligenin
TRC-A794525-5MG 5 mg

Atractyligenin

Sign In for Pricing
View Details
1,6-Anhydro-beta-D-mannopyranose
TRC-A652500-1G 1 g

1,6-Anhydro-beta-D-mannopyranose

Sign In for Pricing
View Details
PLCD1 (NM_006225) Human Recombinant Protein
TP308263M 100 µg

PLCD1 (NM_006225) Human Recombinant Protein

Sign In for Pricing
View Details
OR7E85BP Human Gene Knockout Kit (CRISPR)
KN419740 1 Kit

OR7E85BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details