Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B5 (PCDGH), partial

This Recombinant Human Protocadherin gamma-B5 (PCDGH), partial spans the amino acid sequence from region 31-687. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protocadherin gamma-B5; PCDH-gamma-B5; PCDHGB5

UniProt

Q9Y5G0

Expression Region

31-687

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AU1 (NM_001004731) Human Over-expression Lysate
LY423914 100 µg

OR5AU1 (NM_001004731) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LOC645188 activation kit by CRISPRa
GA118753 1 Kit

Human LOC645188 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Chloro-2,7-naphthalenedisulfonic Acid
TRC-C588290-500MG 500 mg

3-Chloro-2,7-naphthalenedisulfonic Acid

Sign In for Pricing
View Details
Uncoated Mouse NGF (Nerve growth factor) ELISA Kit
E-UNEL-M0037-01 5x 96 Tests

Uncoated Mouse NGF (Nerve growth factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse NGF (Nerve growth factor) ELISA Kit
E-UNEL-M0037-02 15x 96 Tests

Uncoated Mouse NGF (Nerve growth factor) ELISA Kit

Sign In for Pricing
View Details
MSH3 Antibody
8C13090-AAT 50 µg

MSH3 Antibody

Sign In for Pricing
View Details