Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B5 (PCDGH), partial

This Recombinant Human Protocadherin gamma-B5 (PCDGH), partial spans the amino acid sequence from region 31-687. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protocadherin gamma-B5; PCDH-gamma-B5; PCDHGB5

UniProt

Q9Y5G0

Expression Region

31-687

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep290 sgRNA CRISPR Lentivector set (Rat)
K6614301 3x 1.0 µg

Cep290 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
MCM3APAS sgRNA CRISPR Lentivector (Human) (Target 2)
K1280403 1.0 µg DNA

MCM3APAS sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
1,2,4-Trimethoxybenzene
orb3023732-01 50 mg

1,2,4-Trimethoxybenzene

Sign In for Pricing
View Details
1,2,4-Trimethoxybenzene
orb3023732-02 100 mg

1,2,4-Trimethoxybenzene

Sign In for Pricing
View Details
API5, CT (API5, Apoptosis inhibitor 5, Antiapoptosis clone 11 protein, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, Protein XAGL) (MaxLight 405)
MBS6274340-01 0.1 mL

API5, CT (API5, Apoptosis inhibitor 5, Antiapoptosis clone 11 protein, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, Protein XAGL) (MaxLight 405)

Sign In for Pricing
View Details
API5, CT (API5, Apoptosis inhibitor 5, Antiapoptosis clone 11 protein, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, Protein XAGL) (MaxLight 405)
MBS6274340-02 5x 0.1 mL

API5, CT (API5, Apoptosis inhibitor 5, Antiapoptosis clone 11 protein, Cell migration-inducing gene 8 protein, Fibroblast growth factor 2-interacting factor, Protein XAGL) (MaxLight 405)

Sign In for Pricing
View Details