Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyrin domain-containing protein 5 (PYDC5)

This Recombinant Human Pyrin domain-containing protein 5 (PYDC5) spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyrin domain-containing protein 5; Pyrin domain-only protein 3; PYDC5 POP3

UniProt

W6CW81

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddr2 (NM_031764) Rat Tagged Lenti ORF Clone
RR211892L4 10 µg

Ddr2 (NM_031764) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TMEM8C Protein Lysate (Human) with C-Ha Tag
47108031 100 µg

TMEM8C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
BICD2 siRNA (Human)
MBS8235386-01 15 nmol

BICD2 siRNA (Human)

Sign In for Pricing
View Details
BICD2 siRNA (Human)
MBS8235386-02 30 nmol

BICD2 siRNA (Human)

Sign In for Pricing
View Details
BICD2 siRNA (Human)
MBS8235386-03 5x 30 nmol

BICD2 siRNA (Human)

Sign In for Pricing
View Details
RAD1 CRISPR Knock Out 293T Cell Line (Human)
38406141 1x 10^6 Cells / 1.0 mL

RAD1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details