Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (N-Heptafluorobutylamino) -4,6-dichlorotriazine
PC0281 1 Each

2- (N-Heptafluorobutylamino) -4,6-dichlorotriazine

Sign In for Pricing
View Details
Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody
orb535057-01 20 µg

Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody

Sign In for Pricing
View Details
Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody
orb535057-02 100 µg

Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody

Sign In for Pricing
View Details
Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody
orb535057-03 100 ug (without BSA and Azide)

Recombinant Bromodeoxyuridine (BrdU) (Proliferation Marker) Antibody

Sign In for Pricing
View Details
TMEM101 shRNA Plasmid (h)
sc-93800-SH 20 µg

TMEM101 shRNA Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human UCHL1 sgRNA gene knockout kit - Lentiviral human UCHL1 sgRNA gene knockout kit (plasmid)
GTR15364832 1 Vial

Lentiviral human UCHL1 sgRNA gene knockout kit - Lentiviral human UCHL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details