Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FGFR3 (Tyr724) Polyclonal Antibody, Biotin Conjugated
bs-13170R-Biotin 100 µL

Phospho-FGFR3 (Tyr724) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Anti-AMSH-LP/STAMBPL1 Antibody Picoband
MBS1759065-01 0.01 mg

Anti-AMSH-LP/STAMBPL1 Antibody Picoband

Sign In for Pricing
View Details
Anti-AMSH-LP/STAMBPL1 Antibody Picoband
MBS1759065-02 0.1 mg (Carrier Free)

Anti-AMSH-LP/STAMBPL1 Antibody Picoband

Sign In for Pricing
View Details
Anti-AMSH-LP/STAMBPL1 Antibody Picoband
MBS1759065-03 0.1 mg

Anti-AMSH-LP/STAMBPL1 Antibody Picoband

Sign In for Pricing
View Details
Anti-AMSH-LP/STAMBPL1 Antibody Picoband
MBS1759065-04 0.1 mg (Cy3)

Anti-AMSH-LP/STAMBPL1 Antibody Picoband

Sign In for Pricing
View Details
Anti-AMSH-LP/STAMBPL1 Antibody Picoband
MBS1759065-05 0.1 mg (Biotin)

Anti-AMSH-LP/STAMBPL1 Antibody Picoband

Sign In for Pricing
View Details