Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine anti-red cell antibody ELISA Kit
EIA05291p 1 Kit

Porcine anti-red cell antibody ELISA Kit

Sign In for Pricing
View Details
FBXW2 Antibody, Biotin conjugated
A71473-100UG 100 µg

FBXW2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Klf13 (NM_021366) Mouse Tagged ORF Clone Lentiviral Particle
MR224297L3V 200 µL

Klf13 (NM_021366) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FUEL250X26RL-T1-LL-P18 Pipe Markers for Other Liquids
N000981 30 Pack (30 Marker (s) x 1 Roll)

FUEL250X26RL-T1-LL-P18 Pipe Markers for Other Liquids

Sign In for Pricing
View Details
PRSS33 shRNA (h) Lentiviral Particles
sc-93242-V 200 µL

PRSS33 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
pCDH-CMV-ZER1 Plasmid
PVT34950 2 µg

pCDH-CMV-ZER1 Plasmid

Sign In for Pricing
View Details