Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-1β Precoated ELISA Kit
1310122 96 Tests

Rat IL-1β Precoated ELISA Kit

Sign In for Pricing
View Details
Carboxypeptidase A3 (CPA3) Polyclonal Antibody
CAU24334-01 100 µL

Carboxypeptidase A3 (CPA3) Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase A3 (CPA3) Polyclonal Antibody
CAU24334-02 200 µL

Carboxypeptidase A3 (CPA3) Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase A3 (CPA3) Polyclonal Antibody
CAU24334-03 1 mL

Carboxypeptidase A3 (CPA3) Polyclonal Antibody

Sign In for Pricing
View Details
GPR101 Rabbit Polyclonal Antibody
TA315875 100 µL

GPR101 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein 15 (KLK15) (NM_138563) Human Tagged ORF Clone
RG223726 10 µg

Kallikrein 15 (KLK15) (NM_138563) Human Tagged ORF Clone

Sign In for Pricing
View Details