Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA DRB4 Rabbit Polyclonal Antibody
orb627722-01 50 µg

HLA DRB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HLA DRB4 Rabbit Polyclonal Antibody
orb627722-02 100 µg

HLA DRB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR2AG2 shRNA Plasmid (h)
sc-96782-SH 20 µg

OR2AG2 shRNA Plasmid (h)

Sign In for Pricing
View Details
ACOT8 sgRNA CRISPR Lentivector (Human) (Target 1)
K0030302 1.0 µg DNA

ACOT8 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CIKS Antibody : FITC (OAPB00155-FITC)
OAPB00155-100UG-FITC 0.1 mg

CIKS Antibody : FITC (OAPB00155-FITC)

Sign In for Pricing
View Details
OAAB07226-400UL - PTP1B Antibody
OAAB07226-400UL 400 µL

OAAB07226-400UL - PTP1B Antibody

Sign In for Pricing
View Details