Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MIP-2 ELISA Kit
orb1658278 96 Tests

Mouse MIP-2 ELISA Kit

Sign In for Pricing
View Details
4,4-Dimethoxy-2-butanone
orb1692721 5 g

4,4-Dimethoxy-2-butanone

Sign In for Pricing
View Details
TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP) -associated Factor, 135kD (TAF4)
T0703-08 100 µg

TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP) -associated Factor, 135kD (TAF4)

Sign In for Pricing
View Details
Phospho-BCL2 (S87) Antibody
CSB-PA040191-01 50 µg

Phospho-BCL2 (S87) Antibody

Sign In for Pricing
View Details
Phospho-BCL2 (S87) Antibody
CSB-PA040191-02 100 µg

Phospho-BCL2 (S87) Antibody

Sign In for Pricing
View Details
TJP3, NT (TJP3, ZO3, Tight junction protein ZO-3, Tight junction protein 3, Zona occludens protein 3, Zonula occludens protein 3) (MaxLight 490) discontinued
042859-ML490 100 µL

TJP3, NT (TJP3, ZO3, Tight junction protein ZO-3, Tight junction protein 3, Zona occludens protein 3, Zonula occludens protein 3) (MaxLight 490) discontinued

Sign In for Pricing
View Details