Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sofosbuvir-d6
CS-O-10984 1 Each

Sofosbuvir-d6

Sign In for Pricing
View Details
Canine IL-12 (Interleukin 12) ValidElisa Kit
EK343904 96 Well

Canine IL-12 (Interleukin 12) ValidElisa Kit

Sign In for Pricing
View Details
OR5AN1 sgRNA CRISPR Lentivector set (Human)
K1516001 3x 1.0 µg

OR5AN1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal ADAT3 Antibody [FITC]
NBP2-99169F 0.1 mL

Rabbit Polyclonal ADAT3 Antibody [FITC]

Sign In for Pricing
View Details
Klk1b11 Mouse siRNA Oligo Duplex (Locus ID 16613)
SR407432 1 Kit

Klk1b11 Mouse siRNA Oligo Duplex (Locus ID 16613)

Sign In for Pricing
View Details
LMNA AAV siRNA Pooled Vector
26906161 1.0 µg

LMNA AAV siRNA Pooled Vector

Sign In for Pricing
View Details