Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pon1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K5023102 1.0 µg DNA

Pon1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
ALDH1A3 Protein (N-His, Mouse)
P522089 100 µg

ALDH1A3 Protein (N-His, Mouse)

Sign In for Pricing
View Details
Lumisterol
MBS5802641 Inquire

Lumisterol

Sign In for Pricing
View Details
PRKAR1 Polyclonal Antibody
bs-3969R 100 µL

PRKAR1 Polyclonal Antibody

Sign In for Pricing
View Details
Ccdc123 AAV siRNA Pooled Vector
15187164 1.0 µg

Ccdc123 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
4931406H21Rik Mouse shRNA Plasmid (Locus ID 77592)
TL505241 1 Kit

4931406H21Rik Mouse shRNA Plasmid (Locus ID 77592)

Sign In for Pricing
View Details