Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erbin Antibody (Phospho-Tyr1104) : Biotin (OAAF05429-Biotin)
OAAF05429-100UG-Biotin 100 µg

Erbin Antibody (Phospho-Tyr1104) : Biotin (OAAF05429-Biotin)

Sign In for Pricing
View Details
Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)
abx600105-01 20 µg

Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)

Sign In for Pricing
View Details
Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)
abx600105-02 100 µg

Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)

Sign In for Pricing
View Details
Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)
abx600105-03 1 mg

Human Bactericidal Permeability-Increasing Protein (BPI) Protein (Biotin)

Sign In for Pricing
View Details
NOXIN discontinued
392307 200 µL

NOXIN discontinued

Sign In for Pricing
View Details
Anti-KCNV1 Antibody
CTA3696-01 30 µL

Anti-KCNV1 Antibody

Sign In for Pricing
View Details