Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xlr-set siRNA/shRNA/RNAi Lentivector (Mouse)
50539094 4x 500 ng

Xlr-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Cyclolysin secretion/processing ATP-binding protein CyaB (cyaB), partial
MBS1169175-01 1 mg (E-Coli)

Recombinant Bordetella pertussis Cyclolysin secretion/processing ATP-binding protein CyaB (cyaB), partial

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Cyclolysin secretion/processing ATP-binding protein CyaB (cyaB), partial
MBS1169175-02 1 mg (Yeast)

Recombinant Bordetella pertussis Cyclolysin secretion/processing ATP-binding protein CyaB (cyaB), partial

Sign In for Pricing
View Details
POLR2A (Phospho-S2) Rabbit mAb Antibody
orb615148-01 50 μL

POLR2A (Phospho-S2) Rabbit mAb Antibody

Sign In for Pricing
View Details
POLR2A (Phospho-S2) Rabbit mAb Antibody
orb615148-02 100 µL

POLR2A (Phospho-S2) Rabbit mAb Antibody

Sign In for Pricing
View Details
FAM92A2 3'UTR Lenti-reporter-Luc Vector
57352081 1.0 µg

FAM92A2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details