Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 5-48 (LV548) spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 5-48 IGLV5-48

UniProt

A0A075B6I7

Expression Region

20-105

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPTSLSASPGASARLTCTLRSGISVGSYRIYWYQQKPGSPPRYLLNYYSDSDKHQGSGVPSRFSGSKDASTNAGILFISGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein, alpha (BSA & Azide Free) (MaxLight 650) discontinued
S9500-11X-ML650 100 µL

Synuclein, alpha (BSA & Azide Free) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal SMC1 [p Ser966] Antibody [DyLight 488]
NB100-206G 100 µL

Rabbit Polyclonal SMC1 [p Ser966] Antibody [DyLight 488]

Sign In for Pricing
View Details
NIPSNAP3A Knockout jurkat Polyclonal Cells
ARG13312 1 Million

NIPSNAP3A Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-JMJD1A/JHDM2A Antibody, Affinity Purified
A301-539A-T 10 µg

Rabbit anti-JMJD1A/JHDM2A Antibody, Affinity Purified

Sign In for Pricing
View Details
Rac cotinine
288694-01 2 mg

Rac cotinine

Sign In for Pricing
View Details
Rac cotinine
288694-02 5 mg

Rac cotinine

Sign In for Pricing
View Details