Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RPP1 Polyclonal Antibody
MBS9017890 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RPP1 Polyclonal Antibody

Sign In for Pricing
View Details
SCF, murine recombinant protein
P1037-.1 100 µg

SCF, murine recombinant protein

Sign In for Pricing
View Details
Pcna (NM_011045) Mouse Tagged ORF Clone
MR203392 10 µg

Pcna (NM_011045) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FOXK2 Rabbit Polyclonal Antibody
orb592873 100 µL

FOXK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PRKN Protein, N-His
HT315012-01 50 µg

Recombinant Human PRKN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PRKN Protein, N-His
HT315012-02 100 µg

Recombinant Human PRKN Protein, N-His

Sign In for Pricing
View Details