Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3G (NM_000073) Human 3' UTR Clone
SC208850 10 µg

CD3G (NM_000073) Human 3' UTR Clone

Sign In for Pricing
View Details
Tpo-set siRNA/shRNA/RNAi Lentivector (Mouse)
47381094 4x 500 ng

Tpo-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Check Valve Kit
U10091 1 Each

Check Valve Kit

Sign In for Pricing
View Details
Serine/threonine-protein phosphatase 2A activator
AP87003 1 mg

Serine/threonine-protein phosphatase 2A activator

Sign In for Pricing
View Details
Polyclonal TDP-43 / TARDBP Antibody (Internal)
APR11207G 0.05mg

Polyclonal TDP-43 / TARDBP Antibody (Internal)

Sign In for Pricing
View Details
Rat visfatin ELISA Kit
GA-E0479RT-01 48 Tests

Rat visfatin ELISA Kit

Sign In for Pricing
View Details