Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746)

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pECMV-Ctgf-m-FLAG Plasmid
PVT15138 2 µg

pECMV-Ctgf-m-FLAG Plasmid

Sign In for Pricing
View Details
FPR1 Rabbit pAb
A20455 200 µL

FPR1 Rabbit pAb

Sign In for Pricing
View Details
Rhebl1 Mouse Gene Knockout Kit (CRISPR)
KN514761 1 Kit

Rhebl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACVR1 Recombinant Protein
OPCD01062-10UG 10 µg

ACVR1 Recombinant Protein

Sign In for Pricing
View Details
Mouse ARMC7 shRNA Plasmid
abx983162-01 150 µg

Mouse ARMC7 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ARMC7 shRNA Plasmid
abx983162-02 300 µg

Mouse ARMC7 shRNA Plasmid

Sign In for Pricing
View Details