Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-37 (LV537)

This Recombinant Human Immunoglobulin lambda variable 5-37 (LV537) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-37 IGLV5-37

UniProt

A0A075B6J1

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rce1 shRNA (UAS) - Lentiviral mouse Rce1 shRNA (UAS) (25)
GTR15219485 1 Vial

Lentiviral mouse Rce1 shRNA (UAS) - Lentiviral mouse Rce1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Phospho-ZCWCC1 (Ser739) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1814454 100 µL

Phospho-ZCWCC1 (Ser739) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
TXLNB Rabbit Polyclonal Antibody (BF405)
orb2537288 100 µL

TXLNB Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
ST6GALNAC5 Human Over-expression Lysate
orb1371608 20 µg

ST6GALNAC5 Human Over-expression Lysate

Sign In for Pricing
View Details
REG1B Antibody
MBS9430368-01 0.1 mL

REG1B Antibody

Sign In for Pricing
View Details
REG1B Antibody
MBS9430368-02 5x 0.1 mL

REG1B Antibody

Sign In for Pricing
View Details