Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-37 (LV537)

This Recombinant Human Immunoglobulin lambda variable 5-37 (LV537) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-37 IGLV5-37

UniProt

A0A075B6J1

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Zfp207 Plasmid
PVT39990 2 µg

pExpress-1-Zfp207 Plasmid

Sign In for Pricing
View Details
4930590J08Rik (NM_198668) Mouse Untagged Clone
MC222725 10 µg

4930590J08Rik (NM_198668) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal KAT2A/GCN5 Antibody (3G13) [Alexa Fluor 488]
NBP1-48593AF488 0.1 mL

Mouse Monoclonal KAT2A/GCN5 Antibody (3G13) [Alexa Fluor 488]

Sign In for Pricing
View Details
AGER CRISPR All-in-one AAV vector set (with saCas9)(Human)
11512151 3x 1.0 µg DNA

AGER CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Porcine Prokineticin Receptor 2 PKR2 ELISA Kit
BG-POR11826 1 Each

Porcine Prokineticin Receptor 2 PKR2 ELISA Kit

Sign In for Pricing
View Details
Human Solute carrier family 22 member 5 (SLC22A5) (NM_003060) AAV Particle
RC204177A1V 250 µL

Human Solute carrier family 22 member 5 (SLC22A5) (NM_003060) AAV Particle

Sign In for Pricing
View Details