Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Bovis pheA Protein (aa 1-321)
VAng-Yyj3147-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis pheA Protein (aa 1-321)

Sign In for Pricing
View Details
KLHL14 siRNA (m)
sc-146515 10 µM

KLHL14 siRNA (m)

Sign In for Pricing
View Details
TA-01 10mM * 1mL in DMSO
A16236-10mM-D 10 mM x 1mL in DMSO

TA-01 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Histone H4, acetylated (Lys5, Lys8, Lys12, Lys16) Antibody Kit, BioAssayTM
H5110-15J 1 Kit

Histone H4, acetylated (Lys5, Lys8, Lys12, Lys16) Antibody Kit, BioAssayTM

Sign In for Pricing
View Details
Borapetoside E
orb1683050 5 mg

Borapetoside E

Sign In for Pricing
View Details
Anti-RNF20 Antibody Picoband®, FITC Conjugate
A03457-1-FITC 100 µg/Vial

Anti-RNF20 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details