Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322)

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SHC/SHC1 Antibody Picoband® Fluoro594 Conjugated
PB9391-Fluoro594 100 µg/Vial

Anti-SHC/SHC1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Teicoplanin sodium
T75273-01 5 mg

Teicoplanin sodium

Sign In for Pricing
View Details
Teicoplanin sodium
T75273-02 50 mg

Teicoplanin sodium

Sign In for Pricing
View Details
FITC Rat IgG2b isotype Control
MBS9472493-01 25 Tests

FITC Rat IgG2b isotype Control

Sign In for Pricing
View Details
FITC Rat IgG2b isotype Control
MBS9472493-02 100 Tests

FITC Rat IgG2b isotype Control

Sign In for Pricing
View Details
FITC Rat IgG2b isotype Control
MBS9472493-03 5x 100 Tests

FITC Rat IgG2b isotype Control

Sign In for Pricing
View Details