Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316)

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Tubulin Alpha 3C ELISA Kit
MBS018930 Inquire

Fish Tubulin Alpha 3C ELISA Kit

Sign In for Pricing
View Details
OR2AG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1491505 3x 1.0 µg

OR2AG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GRSF1 Recombinant Antibody, Cy7 Conjugated
bsm-62226R-Cy7-01 20 µL

GRSF1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
GRSF1 Recombinant Antibody, Cy7 Conjugated
bsm-62226R-Cy7-02 100 µL

GRSF1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Occludin Rabbit Polyclonal Antibody (HRP)
orb477448 100 µL

Occludin Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lomefloxacin Hydrochloride (LMF), 98.5%
52737-01 1 g

Lomefloxacin Hydrochloride (LMF), 98.5%

Sign In for Pricing
View Details