Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-12 (LV312)

This Recombinant Human Immunoglobulin lambda variable 3-12 (LV312) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-12 IGLV3-12

UniProt

A0A075B6K2

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lhcb2 Antibody
PHY3288A 150 μg

Lhcb2 Antibody

Sign In for Pricing
View Details
HSPH1 Antibody (Center)
orb1931387-01 50 µL

HSPH1 Antibody (Center)

Sign In for Pricing
View Details
HSPH1 Antibody (Center)
orb1931387-02 100 µL

HSPH1 Antibody (Center)

Sign In for Pricing
View Details
SMARCAL1 Antibody - N-terminal region (ARP72950_P050)
ARP72950_P050 100 µL

SMARCAL1 Antibody - N-terminal region (ARP72950_P050)

Sign In for Pricing
View Details
USP14 Recombinant Protein (Human)
RP034081 100 µg

USP14 Recombinant Protein (Human)

Sign In for Pricing
View Details
SPRR2F Adenovirus (Human)
45391051 1.0 mL

SPRR2F Adenovirus (Human)

Sign In for Pricing
View Details