Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-9 (LV39)

This Recombinant Human Immunoglobulin lambda variable 3-9 (LV39) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-9 IGLV3-9

UniProt

A0A075B6K5

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPLSVSVALGQTARITCGGNNIGSKNVHWYQQKPGQAPVLVIYRDSNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myotilin Polyclonal Antibody, FITC Conjugated
bs-6479R-FITC 100 µL

Myotilin Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae xylA Protein (aa 1-440)
VAng-Cr5543-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae xylA Protein (aa 1-440)

Sign In for Pricing
View Details
ARL16 Polyclonal Antibody, HRP Conjugated
A64627-050 50 µL

ARL16 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human PRMT3 activation kit by CRISPRa
GA106926 1 Kit

Human PRMT3 activation kit by CRISPRa

Sign In for Pricing
View Details
8-Chloro-3,4-dihydro-2H-1-benzothiopyran-4-one
KCA63920-01 250 mg

8-Chloro-3,4-dihydro-2H-1-benzothiopyran-4-one

Sign In for Pricing
View Details
8-Chloro-3,4-dihydro-2H-1-benzothiopyran-4-one
KCA63920-02 2.5 g

8-Chloro-3,4-dihydro-2H-1-benzothiopyran-4-one

Sign In for Pricing
View Details