Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM-VEID-FMK Caspase 6 Detection Kit
FAM500-2 100 Tests

FAM-VEID-FMK Caspase 6 Detection Kit

Sign In for Pricing
View Details
SP3 (NM_003111) Human Over-expression Lysate
LC401084 20 µg

SP3 (NM_003111) Human Over-expression Lysate

Sign In for Pricing
View Details
PBX1 Recombinant Rabbit monoclonal Antibody
HA750598 100 µL

PBX1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]
TA804361BM 100 µL

Thyroglobulin (TG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details
ISOC2 (NM_024710) Human Over-expression Lysate
LY403016 100 µg

ISOC2 (NM_024710) Human Over-expression Lysate

Sign In for Pricing
View Details
THTPA Mouse Monoclonal Antibody [Clone ID: OTI3E10]
CF806046 100 µg

THTPA Mouse Monoclonal Antibody [Clone ID: OTI3E10]

Sign In for Pricing
View Details