Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF502 activation kit by CRISPRa
GA114109 1 Kit

Human ZNF502 activation kit by CRISPRa

Sign In for Pricing
View Details
rac-Synephrine Hydrochloride
TRC-S920001-5MG 5 mg

rac-Synephrine Hydrochloride

Sign In for Pricing
View Details
Cystatin C (CST3) Human Knockdown Lysate
LY300127 100 µg

Cystatin C (CST3) Human Knockdown Lysate

Sign In for Pricing
View Details
Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA500761AM 100 µL

Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-01 50 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-02 100 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details