Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA13 Rabbit Monoclonal Antibody
TA423479 100 µL

HOXA13 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
3-Amino-5-bromopyridine-2-carboxylic acid
TRC-A594990-250MG 250 mg

3-Amino-5-bromopyridine-2-carboxylic acid

Sign In for Pricing
View Details
CD81 (Mouse/Rat) Recombinant Monoclonal Hamster Antibody (24MS04.81), CF®488A Conjugate - Biotium Choice
P017-488A-125 1x 125 µL

CD81 (Mouse/Rat) Recombinant Monoclonal Hamster Antibody (24MS04.81), CF®488A Conjugate - Biotium Choice

Sign In for Pricing
View Details
ZC3H12B (NM_001010888) Human Over-expression Lysate
LY423209 100 µg

ZC3H12B (NM_001010888) Human Over-expression Lysate

Sign In for Pricing
View Details
Cysteinyldopa Hydrochloride (contains up to 20% inorganics)
TRC-C448225-5MG 5 mg

Cysteinyldopa Hydrochloride (contains up to 20% inorganics)

Sign In for Pricing
View Details
SPTLC1 Antibody
KC-30607-01 50 μL

SPTLC1 Antibody

Sign In for Pricing
View Details