Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1)

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid
OR1032345-01 100 mg

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid
OR1032345-02 250 mg

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid
OR1032345-03 1 g

4-Ethoxy-2- (methylthio) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
IFRD1 (NM_001550) Human Mass Spec Standard
PH317538 10 µg

IFRD1 (NM_001550) Human Mass Spec Standard

Sign In for Pricing
View Details
Research Grade Anti-Human CD340/ERBB2/HER2/NEU (PF-06888667)
DHC09663 100 μg

Research Grade Anti-Human CD340/ERBB2/HER2/NEU (PF-06888667)

Sign In for Pricing
View Details
FMO1 Rabbit pAb
E47R16152 100 µL

FMO1 Rabbit pAb

Sign In for Pricing
View Details