Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-28 (KV228)

This Recombinant Human Immunoglobulin kappa variable 2-28 (KV228) spans the amino acid sequence from region 20-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-28 IGKV2-28

UniProt

A0A075B6P5

Expression Region

20-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF447 (ZSCAN18) (NM_001145543) Human Recombinant Protein
TP327637M 100 µg

ZNF447 (ZSCAN18) (NM_001145543) Human Recombinant Protein

Sign In for Pricing
View Details
Human NBPF9 activation kit by CRISPRa
GA118289 1 Kit

Human NBPF9 activation kit by CRISPRa

Sign In for Pricing
View Details
Nck (NCK1) (NM_001291999) Human Tagged ORF Clone
RG237842 10 µg

Nck (NCK1) (NM_001291999) Human Tagged ORF Clone

Sign In for Pricing
View Details
CBX3 Antibody
KC-4102-01 50 μL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-4102-02 100 µL

CBX3 Antibody

Sign In for Pricing
View Details
CBX3 Antibody
KC-4102-03 1 mL

CBX3 Antibody

Sign In for Pricing
View Details