Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64 (HV364)

This Recombinant Human Immunoglobulin heavy variable 3-64 (HV364) spans the amino acid sequence from region 21-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64 IGHV3-64

UniProt

A0A075B6Q5

Expression Region

21-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGEGLVQPGGSLRLSCAASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMGSLRAEDMAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3”-O-tert-Butyl-2’-deoxymugineic Acid tert-Butyl Diethyl Ester
TRC-B809110-50MG 50 mg

3”-O-tert-Butyl-2’-deoxymugineic Acid tert-Butyl Diethyl Ester

Sign In for Pricing
View Details
16-Deacetylfusidic Acid gamma-Lactone
TRC-D199075-25MG 25 mg

16-Deacetylfusidic Acid gamma-Lactone

Sign In for Pricing
View Details
CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL
BNC040813-500 1x 500 µL

CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Aminophthalic Acid Hydrochloride Dihydrate, Technical Grade
TRC-A627710-5G 5 g

3-Aminophthalic Acid Hydrochloride Dihydrate, Technical Grade

Sign In for Pricing
View Details
Jag1 Mouse Gene Knockout Kit (CRISPR)
KN308537 1 Kit

Jag1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp286 Mouse Gene Knockout Kit (CRISPR)
KN519775 1 Kit

Zfp286 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details